Entity class All entity classes Peptide Modified peptide / analogue Small molecule / cofactor Metal-peptide complex Glycoprotein / biological product Mixture / heterogeneous subject
Structure data All structure data 2D structure available Sequence available Formula/MW available Form-dependent Mixture / no single structure
Modification feature All modification features Lipidated / long-chain conjugated Cyclic Disulfide-containing Amidated Acetylated Non-natural amino acid Metal complex Glycosylated / heterogeneous
This explorer summarizes governed structural/chemistry identity data for education only. It is not a pharmacopeial reference, and it does not provide dosing, preparation, or handling guidance.
Structure records Modified peptide / analogue
Semaglutide
Exact compound record
Exact modified-residue sequence notation was not frozen for public display in v1.
Formula/MW 2D
Molecular Identity
Sequence Not frozen in this dataset
Residue count 31
Structural form linear modified peptide
Modifications Lipidated / long-chain conjugated Non-natural amino acid GLP-1 analogue; lipidated side chain; non-native substitutions.
Chemistry
Molecular formula C187H291N45O59
Molecular weight 4114 g/mol
PubChem CID 56843331
2D structure Structure data available 3D Structure
Experimental availability No exact experimental structure identified Limitations
• Exact modified-residue sequence notation was not frozen for public display in v1. Modified peptide / analogue
Cagrilintide
Exact compound record
Sequence Formula/MW 2D
Molecular Identity
Sequence XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP 38 sequence tokens as reported by PubChem; "X" denotes a non-standard/modified residue notation.
Residue count 38
Structural form modified peptide with disulfide-containing cyclic region / long-acting conjugation
Modifications Disulfide-containing Non-natural amino acid Chemistry
Molecular formula C194H312N54O59S2
Molecular weight 4409 g/mol
PubChem CID 171397054
2D structure Structure data available 3D Structure
Experimental availability No exact experimental structure identified Modified peptide / analogue
Tirzepatide
Exact compound record
Formula/MW 2D
Molecular Identity
Sequence Not frozen in this dataset
Residue count 39
Structural form linear synthetic peptide conjugated to a C20 fatty diacid
Modifications Lipidated / long-chain conjugated Non-natural amino acid Non-native residues/substitutions and fatty-diacid conjugation.
Chemistry
Molecular formula C225H348N48O68
Molecular weight 4813 g/mol
PubChem CID 156588324
2D structure Structure data available 3D Structure
Experimental availability No exact experimental structure identified Modified peptide / analogue
Survodutide
Exact compound record
Formula/MW 2D
Molecular Identity
Sequence Not frozen in this dataset
Structural form modified/lipidated peptide
Modifications Lipidated / long-chain conjugated Chemistry
Molecular formula C192H289N47O61
Molecular weight 4232 g/mol
PubChem CID 168429725
2D structure Structure data available 3D Structure
Experimental availability No exact experimental structure identified Small molecule / cofactor
L-Carnitine
Exact compound record
Crystal-structure literature exists for this small molecule; it is not presented here as a peptide macromolecular structure.
Formula/MW 2D
Molecular Identity
Sequence Not applicable as a single discrete structure
Structural form small molecule, (R)-carnitine / levocarnitine Chemistry
Molecular formula C7H15NO3
Molecular weight 161.2 g/mol
PubChem CID 10917
2D structure Structure data available 3D Structure
Experimental availability No exact experimental structure identified Limitations
• Crystal-structure literature exists for this small molecule; it is not presented here as a peptide macromolecular structure. Modified peptide / analogue
Eloralintide
Exact compound record
Formula/MW 2D
Molecular Identity
Sequence Not frozen in this dataset
Structural form modified peptide with cyclic/disulfide-containing region and long-chain conjugation
Modifications Disulfide-containing Lipidated / long-chain conjugated Chemistry
Molecular formula C201H319N49O65S2
Molecular weight 4526 g/mol
PubChem CID 175663130
2D structure Structure data available 3D Structure
Experimental availability No exact experimental structure identified Metal-peptide complex
GHK-Cu
Form-dependent chemistry
Multiple standardized copper/GHK stoichiometric representations exist in PubChem. This record does not display one formula as universally canonical — an exact chemistry value is shown only when the represented form is explicitly labeled.
Sequence 2D Form-dependent
Molecular Identity
Sequence GHK 3 peptide residues (Gly-His-Lys) per GHK ligand.
Residue count 3
Structural form metal coordination complex
Modifications Metal complex Chemistry
Molecular formula Form-dependent chemistry
Molecular weight Form-dependent chemistry PubChem contains more than one copper/GHK stoichiometric representation (CID 133697840; CID 139035031); no single formula is held as canonical.
PubChem CID 133697840; 139035031
2D structure Structure data available (form-labeled) 3D Structure
Experimental availability No exact experimental structure identified Limitations
• Multiple standardized copper/GHK stoichiometric representations exist in PubChem. This record does not display one formula as universally canonical — an exact chemistry value is shown only when the represented form is explicitly labeled. Metal-peptide complex
AHK-Cu
Form-dependent chemistry
The displayed formula/weight is for PubChem's exact monohydrochloride representation, not a generic AHK-Cu value.
Sequence Formula/MW 2D Form-dependent
Molecular Identity
Sequence AHK
Residue count 3
Structural form copper tripeptide complex / salt-sensitive
Modifications Metal complex Chemistry
Molecular formula C15H24ClCuN6O4-
Molecular weight 451.39 g/mol PubChem's monohydrochloride representation (CID 168431292) — not a universal free-complex value.
PubChem CID 168431292
2D structure Structure data available (form-labeled) 3D Structure
Experimental availability No exact experimental structure identified Limitations
• The displayed formula/weight is for PubChem's exact monohydrochloride representation, not a generic AHK-Cu value. Modified peptide / analogue
IGF-1 LR3 (Long R3 IGF-I)
Sequence-defined peptide
An authoritative PubChem compound CID was not frozen for this subject; a deposited vendor substance record (SID 476298412) is insufficient as sole exact chemistry authority.
Molecular Identity
Sequence Not frozen in this dataset
Residue count 83
Structural form modified/extended IGF-I construct Modified/extended IGF-I construct; exact modification detail held pending an identity-grade primary/manufacturer reference.
Chemistry
Molecular formula Not frozen in this dataset
Molecular weight Not frozen in this dataset
2D structure Held pending an exact identity record 3D Structure
Experimental availability No exact experimental structure identified Limitations
• An authoritative PubChem compound CID was not frozen for this subject; a deposited vendor substance record (SID 476298412) is insufficient as sole exact chemistry authority. • The wild-type IGF-I experimental structure must not be substituted for this modified Long R3 IGF-I analogue. Modified peptide / analogue
Thymosin Alpha-1
Exact compound record
Sequence Formula/MW 2D
Molecular Identity
Sequence SDAAVDTSSEITTKDLKEKKEVVEEAEN
Residue count 28
Modifications Acetylated N-terminal acetylation.
Chemistry
Molecular formula C129H215N33O55
Molecular weight 3108.3 g/mol
PubChem CID 16130571
2D structure Structure data available 3D Structure
Experimental availability No exact experimental structure identified Modified peptide / analogue
SNAP-8
Exact compound record
Sequence Formula/MW 2D
Molecular Identity
Sequence Ac-Glu-Glu-Met-Gln-Arg-Arg-Ala-Asp-NH2
Residue count 8
Modifications Acetylated Amidated N-terminal acetylation; C-terminal amidation.
Chemistry
Molecular formula C42H72N16O15S
Molecular weight 1073.2 g/mol
PubChem CID 71587832
2D structure Structure data available 3D Structure
Experimental availability No exact experimental structure identified Peptide
KPV
Exact compound record
Amide or salt forms of KPV are different PubChem records and should not be conflated with this free-acid identity.
Sequence Formula/MW 2D
Molecular Identity
Sequence KPV
Residue count 3
Structural form linear tripeptide, free acid identity Chemistry
Molecular formula C16H30N4O4
Molecular weight 342.43 g/mol
PubChem CID 125672
2D structure Structure data available 3D Structure
Experimental availability No exact experimental structure identified Limitations
• Amide or salt forms of KPV are different PubChem records and should not be conflated with this free-acid identity. Peptide
Glutathione
Exact compound record
Sequence Formula/MW 2D
Molecular Identity
Sequence gamma-Glu-Cys-Gly Linked via a gamma-glutamyl bond, not an ordinary alpha-peptide bond.
Residue count 3 Chemistry
Molecular formula C10H17N3O6S
Molecular weight 307.33 g/mol
PubChem CID 124886
2D structure Structure data available 3D Structure
Experimental availability Not required for this subject Peptide
LL-37
Exact compound record
Experimental-structure availability for LL-37 should be separately curated; no exact PDB entry is frozen in this v1 dataset.
Sequence Formula/MW 2D
Molecular Identity
Sequence [LL-37, 37 aa]
Residue count 37 Chemistry
Molecular formula C205H340N60O53
Molecular weight 4493 g/mol
PubChem CID 16198951
2D structure Structure data available 3D Structure
Experimental availability No exact experimental structure identified Limitations
• Experimental-structure availability for LL-37 should be separately curated; no exact PDB entry is frozen in this v1 dataset. Modified peptide / analogue
Tesamorelin
Exact compound record
Sequence Formula/MW 2D
Molecular Identity
Sequence YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
Residue count 44
Modifications Lipidated / long-chain conjugated N-terminal trans-3-hexenoyl modification.
Chemistry
Molecular formula C221H366N72O67S
Molecular weight 5136 g/mol
PubChem CID 16137828
2D structure Structure data available 3D Structure
Experimental availability No exact experimental structure identified Modified peptide / analogue
TB-500
Exact compound record
Do not substitute the full-length thymosin beta-4 sequence or structure for this database-defined TB-500 heptapeptide identity.
Sequence Formula/MW 2D
Molecular Identity
Sequence Ac-LKKTETQ
Residue count 7
Modifications Acetylated Chemistry
Molecular formula C38H68N10O14
Molecular weight 889 g/mol
PubChem CID 62707662
2D structure Structure data available 3D Structure
Experimental availability No exact experimental structure identified Limitations
• Do not substitute the full-length thymosin beta-4 sequence or structure for this database-defined TB-500 heptapeptide identity. Modified peptide / analogue
GHRP-2 (Pralmorelin)
Exact compound record
PubChem conformer generation is disallowed for this record; no exact experimental structure is frozen.
Sequence Formula/MW 2D
Molecular Identity
Sequence D-Ala-D-2Nal-Ala-Trp-D-Phe-Lys-NH2
Residue count 6
Modifications Non-natural amino acid Amidated Chemistry
Molecular formula C45H55N9O6
Molecular weight 818 g/mol
PubChem CID 6918245
2D structure Structure data available 3D Structure
Experimental availability No exact experimental structure identified Limitations
• PubChem conformer generation is disallowed for this record; no exact experimental structure is frozen. Peptide
DSIP
Exact compound record
Sequence Formula/MW 2D
Molecular Identity
Sequence WAGGDASGE
Residue count 9 Chemistry
Molecular formula C35H48N10O15
Molecular weight 848.8 g/mol
PubChem CID 68816
2D structure Structure data available 3D Structure
Experimental availability No exact experimental structure identified Mixture / heterogeneous subject
HMG / Menotropins
Biological mixture
This subject is a biological mixture, not one discrete molecular structure.
Mixture
Molecular Identity
Sequence Not applicable as a single discrete structure
Structural form mixture containing FSH and LH gonadotropins; each hormone is itself a heterodimeric glycoprotein
Modifications Glycosylated / heterogeneous Chemistry
Molecular formula Not applicable as a single discrete structure
Molecular weight Not applicable as a single discrete structure
2D structure Not applicable as a single discrete structure 3D Structure
Experimental availability Not applicable as a single discrete structure Limitations
• This subject is a biological mixture, not one discrete molecular structure. Modified peptide / analogue
Ipamorelin
Exact compound record
Sequence Formula/MW 2D
Molecular Identity
Sequence Aib-His-D-2Nal-D-Phe-Lys-NH2
Residue count 5
Modifications Non-natural amino acid Amidated Chemistry
Molecular formula C38H49N9O5
Molecular weight 711.9 g/mol
PubChem CID 9831659
2D structure Structure data available 3D Structure
Experimental availability No exact experimental structure identified Peptide
Sermorelin
Exact compound record
Sequence Formula/MW 2D
Molecular Identity
Sequence YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2
Residue count 29
Modifications Amidated Chemistry
Molecular formula C149H246N44O42S
Molecular weight 3357.9 g/mol
PubChem CID 16132413
2D structure Structure data available 3D Structure
Experimental availability No exact experimental structure identified Modified peptide / analogue
CJC-1295 with DAC
Exact compound record
Do not conflate this record with Modified GRF(1-29) ("CJC-1295 without DAC") — they are distinct entities with distinct chemistry.
Formula/MW 2D
Molecular Identity
Sequence Not frozen in this dataset
Structural form maleimido derivative of hGRF(1-29) Chemistry
Molecular formula C165H269N47O46
Molecular weight 3647.2 g/mol
PubChem CID 91971820
2D structure Structure data available 3D Structure
Experimental availability No exact experimental structure identified Limitations
• Do not conflate this record with Modified GRF(1-29) ("CJC-1295 without DAC") — they are distinct entities with distinct chemistry. Modified peptide / analogue
CJC-1295 without DAC (Modified GRF(1-29))
Sequence-defined peptide
Do not conflate this record with CJC-1295 with DAC — they are distinct entities with distinct chemistry.
Sequence
Molecular Identity
Sequence Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
Residue count 29
Modifications Non-natural amino acid Amidated Modifications versus native GHRH(1-29): D-Ala2; Gln8; Ala15; Leu27; C-terminal amide.
Chemistry
Molecular formula Not frozen in this dataset
Molecular weight Not frozen in this dataset A value of approximately 3368 g/mol is broadly reported in secondary sources but is not promoted as an exact frozen value pending an authoritative standardized compound record.
2D structure Held pending an exact identity record 3D Structure
Experimental availability No exact experimental structure identified Limitations
• Do not conflate this record with CJC-1295 with DAC — they are distinct entities with distinct chemistry. • Secondary sources disagree on exact formula notation; an authoritative record was not pinned for this v1 freeze. Peptide
Kisspeptin-10
Exact compound record
Sequence Formula/MW 2D
Molecular Identity
Sequence YNWNSFGLRF-NH2
Residue count 10
Modifications Amidated Chemistry
Molecular formula C63H83N17O14
Molecular weight 1302.4 g/mol
PubChem CID 25240297
2D structure Structure data available 3D Structure
Experimental availability No exact experimental structure identified Modified peptide / analogue
Bremelanotide (PT-141)
Exact compound record
Sequence Formula/MW 2D
Molecular Identity
Sequence Ac-Nle-Asp-His-D-Phe-Arg-Trp-Lys With intramolecular cyclization as represented by PubChem.
Residue count 7
Modifications Acetylated Cyclic Non-natural amino acid Chemistry
Molecular formula C50H68N14O10
Molecular weight 1025.2 g/mol
PubChem CID 9941379
2D structure Structure data available 3D Structure
Experimental availability No exact experimental structure identified Peptide
PE-22-28
Exact compound record
PubChem also has an acetate record (CID 172871876); the acetate formula must not be substituted unless that material is specifically identified as the acetate.
Sequence Formula/MW 2D
Molecular Identity
Sequence GVSWGLR
Residue count 7 Chemistry
Molecular formula C35H55N11O9
Molecular weight 773.9 g/mol
PubChem CID 165437303
2D structure Structure data available 3D Structure
Experimental availability No exact experimental structure identified Limitations
• PubChem also has an acetate record (CID 172871876); the acetate formula must not be substituted unless that material is specifically identified as the acetate. Peptide
Cortagen
Exact compound record
A PubChem computed conformer exists for this record; it is not labeled or presented here as an experimental structure.
Sequence Formula/MW 2D
Molecular Identity
Sequence AEDP
Residue count 4 Chemistry
Molecular formula C17H26N4O9
Molecular weight 430.4 g/mol
PubChem CID 18439621
2D structure Structure data available 3D Structure
Experimental availability No exact experimental structure identified Limitations
• A PubChem computed conformer exists for this record; it is not labeled or presented here as an experimental structure. Peptide
Oxytocin
Exact compound record
Sequence Formula/MW 2D
Molecular Identity
Sequence CYIQNCPLG
Residue count 9
Structural form cyclic via a disulfide bridge between Cys1 and Cys6
Modifications Cyclic Disulfide-containing Chemistry
Molecular formula C43H66N12O12S2
Molecular weight 1007.2 g/mol
PubChem CID 439302
2D structure Structure data available 3D Structure
Experimental availability No exact experimental structure identified Small molecule / cofactor
Vitamin B12
Form-dependent chemistry
This generic "Vitamin B12" subject does not silently use the cyanocobalamin formula — an exact form-specific chemistry value is shown only when the material form is explicitly labeled.
Form-dependent
Molecular Identity
Sequence Not applicable as a single discrete structure Chemistry
Molecular formula Form-dependent chemistry
Molecular weight Form-dependent chemistry Vitamin B12 has multiple cobalamin forms. PubChem's cyanocobalamin record (C63H88CoN14O14P, MW 1355.4 g/mol, CID 166596686) is shown only as a named reference form, not as the generic "Vitamin B12" subject's canonical value.
2D structure Held pending an exact identity record 3D Structure
Experimental availability No exact experimental structure identified Limitations
• This generic "Vitamin B12" subject does not silently use the cyanocobalamin formula — an exact form-specific chemistry value is shown only when the material form is explicitly labeled. Peptide
VIP (Vasoactive Intestinal Peptide)
Sequence-defined peptide
Sequence
Molecular Identity
Sequence HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
Residue count 28
Modifications Amidated Chemistry
Molecular formula Not frozen in this dataset
Molecular weight Not frozen in this dataset PubChem's synthetic VIP structure record (CID 16129679) has a stereochemistry annotation that is not ideal for a canonical human-sequence card; an exact formula/MW was not frozen pending identity re-verification.
2D structure Held pending an exact identity record 3D Structure
Experimental availability No exact experimental structure identified Mixture / heterogeneous subject
Thymalin
Biological mixture
This subject is a biological mixture, not one discrete molecular structure.
Mixture
Molecular Identity
Sequence Not applicable as a single discrete structure Chemistry
Molecular formula Not applicable as a single discrete structure
Molecular weight Not applicable as a single discrete structure
2D structure Not applicable as a single discrete structure 3D Structure
Experimental availability Not applicable as a single discrete structure Limitations
• This subject is a biological mixture, not one discrete molecular structure. • Do not substitute "thymulin/nonathymulin" or another individual thymic peptide for Thymalin merely because database synonym relationships exist. Peptide
Vesugen
Exact compound record
Sequence Formula/MW 2D
Molecular Identity
Sequence KED
Residue count 3 Chemistry
Molecular formula C15H26N4O8
Molecular weight Not frozen in this dataset Derivable from the exact PubChem CID during a future data-ingest pass; not pinned as an exact value in this v1 freeze.
PubChem CID 87571363
ChEBI ID 159909
2D structure Structure data available 3D Structure
Experimental availability Not required for this subject Peptide
Epitalon (Epithalon)
Exact compound record
A PubChem computed conformer exists for this record; it is not labeled or presented here as an experimental structure.
Sequence Formula/MW 2D
Molecular Identity
Sequence AEDG
Residue count 4 Chemistry
Molecular formula C14H22N4O9
Molecular weight 390.35 g/mol
PubChem CID 219042
2D structure Structure data available 3D Structure
Experimental availability No exact experimental structure identified Limitations
• A PubChem computed conformer exists for this record; it is not labeled or presented here as an experimental structure. Small molecule / cofactor
NAD+
Exact compound record
PubChem's conformer for this record is computed, not an experimental macromolecular model.
Formula/MW 2D
Molecular Identity
Sequence Not applicable as a single discrete structure Chemistry
Molecular formula C21H27N7O14P2
Molecular weight 663.4 g/mol
PubChem CID 10897651
2D structure Structure data available 3D Structure
Experimental availability Not required for this subject Limitations
• PubChem's conformer for this record is computed, not an experimental macromolecular model. Modified peptide / analogue
Retatrutide
Identity record, no discrete structure
An exact standardized compound structure was not frozen for this subject.
Chemistry held
Molecular Identity
Sequence Not frozen in this dataset Chemistry
Molecular formula Not frozen in this dataset
Molecular weight Not frozen in this dataset
2D structure Held pending an exact identity record 3D Structure
Experimental availability No exact experimental structure identified Limitations
• An exact standardized compound structure was not frozen for this subject. • PubChem presents Retatrutide as a Reference Collection identity (SID 528343961) without a discrete standardized CID. Small molecule / cofactor
5-Amino-1MQ
Exact compound record
Counterion/salt form changes finished-material formula/mass; this record describes the cation.
Formula/MW 2D
Molecular Identity
Sequence Not applicable as a single discrete structure Chemistry
Molecular formula C10H11N2+
Molecular weight 159.21 g/mol For the cation; counterion/salt form changes the finished-material formula/mass.
PubChem CID 950107
2D structure Structure data available 3D Structure
Experimental availability No exact experimental structure identified Limitations
• Counterion/salt form changes finished-material formula/mass; this record describes the cation. Modified peptide / analogue
Afamelanotide
Exact compound record
Formula/MW 2D
Molecular Identity
Sequence Not frozen in this dataset
Residue count 13
Modifications Non-natural amino acid Two amino-acid substitutions relative to endogenous alpha-MSH.
Chemistry
Molecular formula C78H111N21O19
Molecular weight 1646.8 g/mol
PubChem CID 16197727
2D structure Structure data available 3D Structure
Experimental availability No exact experimental structure identified Peptide
BPC-157
Exact compound record
Sequence Formula/MW 2D
Molecular Identity
Sequence GEPPPGKPADDAGLV
Residue count 15 Chemistry
Molecular formula C62H98N16O22
Molecular weight 1419.5 g/mol
PubChem CID 9941957
2D structure Structure data available 3D Structure
Experimental availability No exact experimental structure identified Peptide
MOTS-C
Exact compound record
Sequence Formula/MW 2D
Molecular Identity
Sequence MRWQEMGYIFYPRKLR
Residue count 16 Chemistry
Molecular formula C101H152N28O22S2
Molecular weight 2174.6 g/mol
PubChem CID 146675088
2D structure Structure data available 3D Structure
Experimental availability No exact experimental structure identified Peptide
Selank
Exact compound record
Sequence Formula/MW 2D
Molecular Identity
Sequence TKPRPGP
Residue count 7 Chemistry
Molecular formula C33H57N11O9
Molecular weight 751.9 g/mol
PubChem CID 11765600
2D structure Structure data available 3D Structure
Experimental availability Not required for this subject Peptide
Semax
Exact compound record
PubChem CID 9811102 is the standardized Semax-related compound record pinned for this dataset; PubChem also contains salt/depositor variant records (e.g. CID 13068166) that are not used here.
Sequence Formula/MW 2D
Molecular Identity
Sequence MEHFPGP
Residue count 7 Chemistry
Molecular formula C37H51N9O10S
Molecular weight 813.9 g/mol
PubChem CID 9811102
2D structure Structure data available 3D Structure
Experimental availability Not required for this subject Limitations
• PubChem CID 9811102 is the standardized Semax-related compound record pinned for this dataset; PubChem also contains salt/depositor variant records (e.g. CID 13068166) that are not used here. Peptide
Pinealon
Exact compound record
PubChem also has a Pinealon acetate record (CID 155977549); the acetate formula must not be silently substituted for this free-peptide record.
Sequence Formula/MW 2D
Molecular Identity
Sequence EDR
Residue count 3 Chemistry
Molecular formula C15H26N6O8
Molecular weight 418.4 g/mol
PubChem CID 10273502
ChEBI ID 156374
2D structure Structure data available 3D Structure
Experimental availability Not required for this subject Limitations
• PubChem also has a Pinealon acetate record (CID 155977549); the acetate formula must not be silently substituted for this free-peptide record. Glycoprotein / biological product
HCG (Human Chorionic Gonadotropin)
Biological mixture
HCG is a glycosylated multi-subunit hormone, so one simple molecular formula does not adequately represent all product forms.
Mixture
Molecular Identity
Sequence Not applicable as a single discrete structure
Modifications Glycosylated / heterogeneous Chemistry
Molecular formula Not applicable as a single discrete structure
Molecular weight Form-dependent chemistry Molecular weight is form/glycosylation-dependent for this multi-subunit glycoprotein.
2D structure Not applicable as a single discrete structure 3D Structure
Experimental availability Not applicable as a single discrete structure Limitations
• HCG is a glycosylated multi-subunit hormone, so one simple molecular formula does not adequately represent all product forms. • Structural models may exist for hCG/receptor complexes in the literature, but no exact product-wide 3D representation is frozen in this v1 dataset. Modified peptide / analogue
SS-31 (Elamipretide)
Exact compound record
Sequence Formula/MW 2D
Molecular Identity
Sequence D-Arg-Dmt-Lys-Phe-NH2
Residue count 4
Modifications Non-natural amino acid Amidated D-Arg; 2,6-dimethyl-Tyr (Dmt); C-terminal amide.
Chemistry
Molecular formula C32H49N9O5
Molecular weight 639.8 g/mol
PubChem CID 11764719
2D structure Structure data available 3D Structure
Experimental availability Not required for this subject Peptide
ARA-290 (Cibinetide)
Exact compound record
Sequence Formula/MW 2D
Molecular Identity
Sequence XEQLERALNSS X = pyroglutamyl residue (pyroGlu), per PubChem's sequence notation.
Residue count 11 Chemistry
Molecular formula C51H84N16O21
Molecular weight 1257.3 g/mol
PubChem CID 91810664
2D structure Structure data available 3D Structure
Experimental availability No exact experimental structure identified 