Explore sequence length, molecular features, and selected structural modifications.
Each subject below carries an explicit evidence state rather than one forced universal chemistry card. Sequence, molecular formula, molecular weight, and structure availability are shown only when a standardized source was frozen for that exact value — a mixture, form-dependent, or held state is a deliberate scientific outcome, not a missing field.
This explorer summarizes governed structural/chemistry identity data for education only. It is not a pharmacopeial reference, and it does not provide dosing, preparation, or handling guidance.
Structure records
Modified peptide / analogue
Cagrilintide
Exact compound record
SequenceFormula/MW2D
Molecular Identity
Sequence
XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP
38 sequence tokens as reported by PubChem; "X" denotes a non-standard/modified residue notation.
Residue count
38
Structural form
modified peptide with disulfide-containing cyclic region / long-acting conjugation
